Protein Info for BT4105 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): D-galacturonate transporter ExuT
Rationale: Specifically important for D-galacturonate utilization. Also important for utilization of galacturonate-containing polysaccharides polygalacturonate and rhamnogalacturonan from potato, and probably important for pectin utilization as well
Original annotation: hexuronate transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 411 (400 residues), 168.7 bits, see alignment E=1.7e-53 PF00083: Sugar_tr" amino acids 41 to 413 (373 residues), 28.3 bits, see alignment E=8.9e-11

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to bth:BT_4105)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0B6 at UniProt or InterPro

Protein Sequence (495 amino acids)

>BT4105 D-galacturonate transporter ExuT (Bacteroides thetaiotaomicron VPI-5482)
MTNYRWTICAMLFFATTVNYLDRQVLSLTWDEFIKPEFHWDESHYGTITSVFSIVYAICM
LFAGRFVDWMGTKKGFLWAIGVWSAGACLHAVCGIVTEAQVGLHSAAELAGATGDVVVTI
ATVSMYCFLAARCILALGEAGNFPAAIKVTAEYFPKKDRAYATSIFNAGASIGALIAPLT
IPILAKAFGWEMAFIVIGGLGFIWMGFWVFMYDAPSKSKHVNKAELEYIEQDQNEAGAGP
KTEEKDEKKMRFWQCFSYKQTWAFVFGKFTTDGVWWFFLFWTPSYLNSQFGIKTSDPLGM
GLIFTLYAITMLSIYGGKLPTIFINKTGMNPYAARMKAMLIFAFFPLVVLLAQPLGTFSP
WFPVILIGIGGAAHQSWSANIFSTVGDMFPRTAIASITGIGGMAGGIGSMILQKVAGNLF
VYASGTTMVDGKEVEMTKELLEQGAQFVHPAMTFMGFEGKPAGYFVIFCVCAVAYLIGWV
IMKALVPKYKPIVLD