Protein Info for BT4067 in Bacteroides thetaiotaomicron VPI-5482

Annotation: NADH dehydrogenase I, chain A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 57 to 80 (24 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details PF00507: Oxidored_q4" amino acids 19 to 115 (97 residues), 123.1 bits, see alignment E=2.4e-40

Best Hits

Swiss-Prot: 100% identical to NUOA_BACTN: NADH-quinone oxidoreductase subunit A (nuoA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 100% identity to bth:BT_4067)

MetaCyc: 44% identical to ferredoxin-quinone oxidoreductase subunit C (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0F4 at UniProt or InterPro

Protein Sequence (116 amino acids)

>BT4067 NADH dehydrogenase I, chain A (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNFTFLVVVLLTALAFVGVVIALSRAISPRSYNVQKFEAYECGIPTRGKSWMQFRVGYYL
FAILFLMFDVETAFLFPWAVVMHDMGPQGLVSILFFFIILVLGLAYAWRKGALEWK