Protein Info for BT4063 in Bacteroides thetaiotaomicron VPI-5482

Annotation: NADH dehydrogenase I, chain I (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13237: Fer4_10" amino acids 65 to 124 (60 residues), 27.3 bits, see alignment E=1.4e-09 PF00037: Fer4" amino acids 66 to 86 (21 residues), 25.1 bits, see alignment (E = 5.7e-09) amino acids 107 to 129 (23 residues), 30 bits, see alignment 1.6e-10 PF12800: Fer4_4" amino acids 68 to 82 (15 residues), 16.4 bits, see alignment (E = 4.9e-06) amino acids 112 to 124 (13 residues), 14.4 bits, see alignment (E = 2.1e-05) PF13187: Fer4_9" amino acids 69 to 128 (60 residues), 32.3 bits, see alignment E=4.1e-11 PF12838: Fer4_7" amino acids 69 to 127 (59 residues), 46 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 100% identity to bth:BT_4063)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0F8 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BT4063 NADH dehydrogenase I, chain I (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEYKDQKYTYLGGLIHGISTLATGMKTSIKVYFRKKVTEQYPENRKELKMFDRFRGTLAM
PHNENNEHRCVACGLCQIACPNDTITVTSETIETEDGKKKKILAKYEYDLGACMFCQLCV
NACPHDAITFDQNFEHAVFDRTKLVLQLNHAGSKVIEKKKEV