Protein Info for BT4062 in Bacteroides thetaiotaomicron VPI-5482

Annotation: NADH dehydrogenase I, chain J (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00499: Oxidored_q3
  • amino acids 21 to 166 (146 residues), 118.6 bits, E=1e-38

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 100% identity to bth:BT_4062)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See Q8A0F9 at UniProt or InterPro

Protein Sequence (170 amino acids)

>BT4062 NADH dehydrogenase I, chain J (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGSTLETVVFYFLAAFIIAMSIMTVTTQRIVRSATYLLFVLFGTAGIYFLLGYTFLGSVQ
IMVYAGGIVVLYVFSILLTSGEGDRAEKLKRSRFLAGLFTMVAGLAIILFITLKHNFLQT
TNLVPLEINIHTIGNALLSSDKYGYILPFEAISILLLACIIGGIMIARKR