Protein Info for BT4057 in Bacteroides thetaiotaomicron VPI-5482

Annotation: two-component system sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 921 PF01590: GAF" amino acids 147 to 290 (144 residues), 46.2 bits, see alignment E=2.7e-15 PF13185: GAF_2" amino acids 152 to 291 (140 residues), 41.2 bits, see alignment E=7.5e-14 TIGR00229: PAS domain S-box protein" amino acids 426 to 551 (126 residues), 25.4 bits, see alignment E=6.4e-10 PF13426: PAS_9" amino acids 441 to 546 (106 residues), 17.8 bits, see alignment E=1.4e-06 PF08447: PAS_3" amino acids 586 to 673 (88 residues), 31 bits, see alignment E=1e-10 PF00512: HisKA" amino acids 700 to 764 (65 residues), 74.8 bits, see alignment 1.8e-24 PF02518: HATPase_c" amino acids 810 to 913 (104 residues), 102.6 bits, see alignment E=6.7e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4057)

Predicted SEED Role

"Two-component system sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0G4 at UniProt or InterPro

Protein Sequence (921 amino acids)

>BT4057 two-component system sensor histidine kinase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSSLAQIGWWEADFLAGHYVCSDFLCDLLGLEGDTISFMDFQNLIREDYREQIVQEFRAN
ANIHKDFYEQTFPICLKNGEVWLHTRLALREKGTGTNGGDKSFGVIQRVEAPKEVEQKNT
LRRVNDLLRRQNYISQSLLRFLHDDDVDSCIMEILNDVLSLYQGGRVYIFEYNEDYTHHS
CTYEVVSEGVSKEKNKQQSIPVNETRWWCEQILSGKPIILTSLKQLPEEAENEYKFLDAQ
GICSLMVAPLMAGDRVWGFMGIDLVESYREWSNEDFQWFSSLANIISICIELRKAKDRVV
REQSFLSNLFHFMPLGYIRMSVVRDENGQLLDYKITDVNKACSRFFARPAETYIGVLASE
IYPDFSSQLLFLKEVLDNNSYREKDIFFPQTELYTHWIVYSPEKDEVVGLFTDSTEAVKT
NRALDRSEKLFKSIFANIPAGVEIYDKDGFLIDLNNKDLEIFGVENKQDVIGVNFFENPN
VPQHIRDRVRDEDLVDFRLNYSFERAEGYYHPDRRDTIDIYTKVSKLYDNEGNFNGYILI
SIDNTEQIDAMNRIRDFENFFLLISDYAKVGYAKLNLLNRKGYAIKQWYKNLGEEEDTPL
ADVVGVYRNMHPEDRERIFDFYREVRKGNRKHFQGEMRIYRPGKKNEWNWIRMNVVVTTY
NPEENEVEIIGINYDITELKETEKELILARDKAEMMDRLKSAFLANMSHEIRTPLNAIVG
FSDLLVDTENIEERREYIQIVKENNDLLLQLISDILDLSKIEAGTFEFTNGDVDVNMLCE
DIVRSMQMKVKENVELMFDPHLAECRIISDRNRLHQVISNFVNNAIKFTSEGSIRVGYKQ
KGEELEFYVQDTGVGIDAESQAHIFERFVKLNSFVHGTGLGLSICQSIVEQMGGKIGVES
EPGKGSRFWFSLPCFVVMSEE