Protein Info for BT3975 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 3-dehydroquinate synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 8 to 342 (335 residues), 328.9 bits, E=2e-102
• PF01761: DHQ_synthase
  • amino acids 57 to 167 (111 residues), 141.9 bits, E=7e-46
• PF24621: DHQS_C
  • amino acids 170 to 313 (144 residues), 131.4 bits, E=2.5e-42

Best Hits

Swiss-Prot: 56% identical to AROB_PARD8: 3-dehydroquinate synthase (aroB) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 100% identity to bth:BT_3975)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

See Q8A0P6 at UniProt or InterPro

Protein Sequence (353 amino acids)

>BT3975 3-dehydroquinate synthase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKQEVILCESLETSLGRAIERCPHDKLFILTDEHTQRLCLPSLKEVSFLKDAVEICIGA
EDVHKTLETLASVWMALSQQGATRHSLLINLGGGMVTDLGGFAAATFKRGISYINIPTTL
LAMVDASVGGKTGINFNGLKNEIGSFAPADSVLIETEFLRSLDAQNFFSGYAEMLKHGLI
SNTAHWVELLDFNTNNIDYAYLKNMVGRSVQVKEDIVEQDPFEHGIRKALNLGHTAGHAF
ESLALAENRPVLHGYAVAWGIVCELYLSHLKVGFPKDKMRQTIQFIKENYGSFAFDCKQY
EQLYAFMQHDKKNTSGTVNFTLLKEIGDICINQTADKDTIFEMLDFYRECMGV