Protein Info for BT3971 in Bacteroides thetaiotaomicron VPI-5482

Annotation: glutathione peroxidase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF08534: Redoxin" amino acids 21 to 113 (93 residues), 29.2 bits, see alignment E=1.1e-10 PF00578: AhpC-TSA" amino acids 23 to 133 (111 residues), 30.1 bits, see alignment E=6e-11 PF00255: GSHPx" amino acids 24 to 130 (107 residues), 138.9 bits, see alignment E=6.9e-45

Best Hits

Swiss-Prot: 49% identical to BSAA_BACHD: Glutathione peroxidase homolog BsaA (bsaA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 100% identity to bth:BT_3971)

MetaCyc: 45% identical to hydroperoxy fatty acid reductase 2 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0Q0 at UniProt or InterPro

Protein Sequence (180 amino acids)

>BT3971 glutathione peroxidase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKSFILMVITMVCAISLEAQNKSFYDFNVTTIDGKEFPLSSLKGKKVLVVNVASKCGLTP
QYAKLQELYDKYKDKNFVIIGFPANNFMGQEPGSNEEIAQFCSLKYDVTFPMMAKISVKG
KNMSPLYQWLTEKKLNGKEDAPVQWNFQKFMIDENGNWVGFVAPKESPLSEKIVTWIEQE