Protein Info for BT3937 in Bacteroides thetaiotaomicron VPI-5482

Annotation: TPR-domain containing protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF13432: TPR_16" amino acids 202 to 262 (61 residues), 30.8 bits, see alignment E=2.6e-10 amino acids 237 to 298 (62 residues), 28.1 bits, see alignment E=1.8e-09 PF14559: TPR_19" amino acids 209 to 268 (60 residues), 29.3 bits, see alignment E=7.3e-10 PF13181: TPR_8" amino acids 232 to 263 (32 residues), 25.8 bits, see alignment 6.3e-09 amino acids 265 to 298 (34 residues), 13.9 bits, see alignment 4.2e-05 PF00515: TPR_1" amino acids 232 to 264 (33 residues), 33.3 bits, see alignment 2.3e-11 PF13174: TPR_6" amino acids 232 to 263 (32 residues), 20.7 bits, see alignment 4e-07 PF13428: TPR_14" amino acids 232 to 273 (42 residues), 27.2 bits, see alignment 3.2e-09 PF07719: TPR_2" amino acids 233 to 263 (31 residues), 32.3 bits, see alignment (E = 5.2e-11) PF13414: TPR_11" amino acids 238 to 279 (42 residues), 30.1 bits, see alignment 2.4e-10 PF13431: TPR_17" amino acids 253 to 282 (30 residues), 22 bits, see alignment (E = 1.1e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3937)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0T4 at UniProt or InterPro

Protein Sequence (320 amino acids)

>BT3937 TPR-domain containing protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MPNFFKSFFSGKSETPESEKQKNDQKNFEIFKYDGLRAQRMGRPDYAIKCFTEALAIEED
FETMGYLSQLYIPMGETEKARELLEKMAVMEPHVTSTFLTLANVCYIQEDYKAMEEAAGK
AIAIEEGNAVAHFLLGKARKGQDDEIMTIAHLTKAITLKDDFIEARLMRAEALLKMKQYK
ETMEDIDAVLAQNPEEETAILLRGKVKEANGQEEEAETDYKFVTEINPFNEQAYLYLGQL
YINQKKLAEAIALFDEAIELNPNFAEAYKERGRAKLLNGDKDGSVEDMKKSLELNPKDEA
SLNGEFKNLGPKPEALPGIF