Protein Info for BT3919 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative biopolymer transport protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 101 to 223 (123 residues), 99.8 bits, see alignment E=5e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to bth:BT_3919)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0V2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>BT3919 putative biopolymer transport protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNVLMLLAQGAMNMADSLATANPVLTPVSAPEMNMLDMAIKGGWIMIVLGVLSVVCFYIL
FERNYMIRKAGKEDPMFMERIKDYIHSGEIKAAIQYCRTMNTPSARMIEKGISRLGRPIN
DVQVAIENVGNLEVAKLEKGLTVMATISGGAPMLGFLGTVTGMVRAFYEMANAGSGNIDI
TLLSGGIYEAMITTVGGLIVGIIAMFAYNYLVMLVDRVVNKMEARTMEFMDLLNEPAQK