Protein Info for BT3904 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF16576: HlyD_D23" amino acids 47 to 285 (239 residues), 52.5 bits, see alignment E=8.5e-18 PF13533: Biotin_lipoyl_2" amino acids 51 to 93 (43 residues), 36.8 bits, see alignment 5.3e-13 PF13437: HlyD_3" amino acids 211 to 323 (113 residues), 34.8 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 42% identical to AN36_HELPY: 36 kDa antigen (HP_1488) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to bth:BT_3904)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0W7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>BT3904 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAPIKSQNSNMLLAFLTLLGVIAIVAVVGFFMLRKGPEIIQGQAEVTEYRVSSKVPGRIL
EFRVKEGQSVNAGDTLAILEAPDVVAKMEQARAAEAAAQAQNEKAIKGAREEQIQAAYEM
WQKAQAGVTIAEKSYKRVKNLYEQGVMPAQKLDEVTAQRDAAIATEKAAKAQYTMAKNGA
EREDKMAAEALVNRAKGAVAEVESYIKETYLIAPAAGEVSEIFPKVGELVGTGAPIMNIA
ELNDMWVTFNVREDLLKNLTMGAEFEAVVPALDNKTVKLKVYYLKDLGTYAAWKATKTTG
QFDLKTFEVKASPMEKVENLRPGMSVIINK