Protein Info for BT3903 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 235 to 260 (26 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 28 to 376 (349 residues), 134.7 bits, see alignment E=4.4e-43 PF01061: ABC2_membrane" amino acids 200 to 345 (146 residues), 30.5 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to bth:BT_3903)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0W8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>BT3903 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKERKKKYVALWQVMQRECRRLVSRPLYLFCMVIAPLFCYLFFTTLMDSGLPQNLPAGVV
DMDDSSTSRNIVRNLDAFSQTGVVAHYSNVTDARIAVQEGKIYGFFYIPKGLSAEAQSQR
QPKISFYTNYSYLIAGSLLFRDMKMMGELTAGSAARSVLYAKGATEDQAMGFLQPIVIDT
HPLNNPWLNYSVYLCNTLIPGVLMLLIFMVTVYSIGVEIKDRTAREWLRMSNNSIYIALA
GKLLPHTVVFFIMGIFYNVYLYGFLHFPCNSGIFPMIFATLCLVLASQCCGIVMIGTLPT
LRLGLSFASLWGVISFSISGFSFPVMAMNPVLQALSNLFPLRHYFLIYVDQALNGYSMAY
SWSNYMALLIFMMLPFFVVHRLKEALVYYKYIP