Protein Info for BT3863 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 267 to 283 (17 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details amino acids 457 to 474 (18 residues), see Phobius details amino acids 486 to 505 (20 residues), see Phobius details amino acids 515 to 536 (22 residues), see Phobius details amino acids 556 to 578 (23 residues), see Phobius details amino acids 584 to 601 (18 residues), see Phobius details amino acids 613 to 632 (20 residues), see Phobius details amino acids 644 to 661 (18 residues), see Phobius details amino acids 673 to 694 (22 residues), see Phobius details amino acids 704 to 721 (18 residues), see Phobius details amino acids 728 to 746 (19 residues), see Phobius details amino acids 758 to 775 (18 residues), see Phobius details PF10101: DUF2339" amino acids 154 to 777 (624 residues), 250.2 bits, see alignment E=2.9e-78

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3863)

Predicted SEED Role

"NADH dehydrogenase subunit 2" in subsystem Respiratory Complex I

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A108 at UniProt or InterPro

Protein Sequence (791 amino acids)

>BT3863 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGELYGTCALLAAVLFFVLLQKFESRFGKVDKELGEIKKRMDDLLKAQEKMASGPVRAKE
DVTAETLDNTDILPYVTEELPDSTVTALKEEKAVEEKAVEGIQPIMAETTPQKLNASLEK
ESAEATLQETSPEAPLEIPSVSKRKQVNYEKFIGENLFGKIGILVFVIGVGFFVKYAIDK
DWINETLRTVLGFLTGSALLVVAERLQKKYRTFSSLLAGGAFAVFYLTVAIAFHFYHLFP
QTVAFIILIATTLFMSILSILYDRRELAIISLVGGFLAPFLVSTGNGNYLVLFTYMSILN
LGMFGLSIYMKWGELPVIAFVFTYVVMGIFLLTGFTTGSTHISVHLFIFATLFYFIFLLP
ILSILRIEAVKKNRGLLLVIITNNFIYLLLGILFLRNMGLPFKSEGLLSLLIAIINLVLV
IWLRMSKKDYKFLIYAMLGLVLTFVSITIPIQLDGNYITLFWAAEMVLLLWLYVKSKIGV
YERATQVLMGLTLVSYLMDIYNVLMTSSSSETIFLNSSFATSLFVGLATGAFALLMGRYR
SLFTEARYLRYTPWNSIMLLAAAAILYYTFMAEFALHLAGATRSGMMLAFTSAAIFILSY
TFKKRFPIKQYTIPYLTAMGMNVLIYVINIWGDQWVYTSLTPALLRWFAAAFVIANLYYV
ARQYYTLIGLKTPFTVYLNVLALFLWLTMARSFLLQAGVEDFDAGFSVSLSIAGFIQMAL
GMRLHQKVLRIISLSTFGIVLLKLILKDLWAMPTIGKIIVFIILGLILLILSFLYQKLKD
VLFKNDEDETD