Protein Info for BT3858 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 9 to 737 (729 residues), 763.3 bits, see alignment E=1.2e-233 PF17678: Glyco_hydro_92N" amino acids 38 to 233 (196 residues), 83.8 bits, see alignment E=1.8e-27 PF07971: Glyco_hydro_92" amino acids 239 to 733 (495 residues), 523.3 bits, see alignment E=6.6e-161

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3858)

MetaCyc: 100% identical to alpha-1,3-mannosidase (Bacteroides thetaiotaomicron)
3.2.1.-

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A113 at UniProt or InterPro

Protein Sequence (755 amino acids)

>BT3858 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MMMNRLNIKRTVGSCLMAMAFFSCTHTDQTPTKDFVDYVNPYIGNISHLLVPTYPTVHLP
NSMLRVYPERGDYTSDRVNGLPVVVTSHRGSSAFNLSPVQGEVSRPIVSYSYDLENITPY
SYSVYLDEADIQVEYAPSHQAGIYHISFGTEGDNALVVNTKNGKLVAEEKGVSGYQVIDN
TPTKIYLYLETSQLPLRKGVLADGKVDMESKEGSAIALYYGSEKNLNLRYGISFISAEQA
KKNLQRDITTYDVKAVADAGRRIWNKTLGKIVIEGGSEDEKEIFYTSLYRTYERMINLSE
DGKYYSAFDGKIHEDGGVPFYTDDWIWDTYRATHPLRILIEPQKELDMIRSYIRMAEQSD
RRWMPTFPEVTGDSHRMNGNHAVAVIWDAYCKGLKDFDLEAAYEACKGAITEKTLLPWLR
CPLTELDKFYQEKGFFPALNPGEEETCKAVHSFERRQAVAVMLGNCYDNWCLAQIARTLN
KTDDYKKFMRMSYTYRNVYNAETGFFHPKNKDGKFIEPFDYRYSGGQGARGYYGENNGWI
YRWDVQHNPADLIALMGGQASFIERLNQTFNEPLGRSKFDFYHQLPDHTGNVGQFSMANE
PCLHIPYLYNYAGQPWMTQKRIRVLLNQWFRNDLMGVPGDEDGGGMTAFVVFSMMGFYPV
TPGSPTYNIGSPVFQSAKMEVGDGHYFEIIAENYAPDHKYIQSATLNGTPWNKPWFSHAD
IQNGGRLVLQMGDKPNKKWGIASDAVPPSSESLPE