Protein Info for BT3845 in Bacteroides thetaiotaomicron VPI-5482

Annotation: inosine-5'-monophosphate dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF00478: IMPDH" amino acids 12 to 477 (466 residues), 530.8 bits, see alignment E=3.6e-163 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 12 to 459 (448 residues), 625.4 bits, see alignment E=3e-192 PF00571: CBS" amino acids 97 to 144 (48 residues), 50.7 bits, see alignment 4.5e-17 amino acids 157 to 208 (52 residues), 38.4 bits, see alignment 3.3e-13 PF01645: Glu_synthase" amino acids 261 to 366 (106 residues), 22.4 bits, see alignment E=1.6e-08 PF01070: FMN_dh" amino acids 274 to 366 (93 residues), 27.3 bits, see alignment E=4.6e-10

Best Hits

Swiss-Prot: 60% identical to IMDH_BACHD: Inosine-5'-monophosphate dehydrogenase (guaB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to bth:BT_3845)

MetaCyc: 54% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A126 at UniProt or InterPro

Protein Sequence (492 amino acids)

>BT3845 inosine-5'-monophosphate dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSFIADKIVMDGLTYDDVLLIPAYSEVLPRTVDLSTKFSRNIELKIPFVTAAMDTVTEAK
MAIAIAREGGIGVIHKNMSIEEQARQVAIVKRAENGMIYDPVTIKRGSTVSDALGIMAEY
KIGGIPVVDDEGYLVGIVTNRDLRFERDMTKHIDLVMTPKERLVTTNQSTDLESAAQILQ
KHKIEKLPIVGMDGKLIGLVTYKDITKAKDKPMACKDAKGRLRVAAGVGVTADTLDRMQA
LVDAGADAIVIDTAHGHSMYVIEKLKEAKKRFPNIDIVVGNIATGEAAKALAEAGADAVK
VGIGPGSICTTRVVAGVGVPQLSAVYDVAKALKGTGVPLIADGGLRYSGDVVKALAAGGY
CVMIGSLVAGTEESPGDTIIFNGRKFKSYRGMGSLEAMENGSKDRYFQSGTADVKKLVPE
GIAARVPYKGTLYEVVYQLSGGLRAGMGYCGAANIEKLHDAKFTRITNAGVMESHPHDVT
ITSESPNYSRPE