Protein Info for BT3845 in Bacteroides thetaiotaomicron VPI-5482

Annotation: inosine-5'-monophosphate dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 12 to 459 (448 residues), 625.4 bits, E=3e-192
• PF00478: IMPDH
  • amino acids 12 to 477 (466 residues), 530.8 bits, E=3.6e-163
• PF00571: CBS
  • amino acids 97 to 144 (48 residues), 50.7 bits, 4.5e-17
  • amino acids 157 to 208 (52 residues), 38.4 bits, 3.3e-13
• PF01645: Glu_synthase
  • amino acids 261 to 366 (106 residues), 22.4 bits, E=1.6e-08
• PF01070: FMN_dh
  • amino acids 274 to 366 (93 residues), 27.3 bits, E=4.6e-10

Best Hits

Swiss-Prot: 60% identical to IMDH_BACHD: Inosine-5'-monophosphate dehydrogenase (guaB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to bth:BT_3845)

MetaCyc: 54% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• purine nucleotides degradation II (aerobic) (7/11 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (3/7 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See Q8A126 at UniProt or InterPro

Protein Sequence (492 amino acids)

>BT3845 inosine-5'-monophosphate dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSFIADKIVMDGLTYDDVLLIPAYSEVLPRTVDLSTKFSRNIELKIPFVTAAMDTVTEAK
MAIAIAREGGIGVIHKNMSIEEQARQVAIVKRAENGMIYDPVTIKRGSTVSDALGIMAEY
KIGGIPVVDDEGYLVGIVTNRDLRFERDMTKHIDLVMTPKERLVTTNQSTDLESAAQILQ
KHKIEKLPIVGMDGKLIGLVTYKDITKAKDKPMACKDAKGRLRVAAGVGVTADTLDRMQA
LVDAGADAIVIDTAHGHSMYVIEKLKEAKKRFPNIDIVVGNIATGEAAKALAEAGADAVK
VGIGPGSICTTRVVAGVGVPQLSAVYDVAKALKGTGVPLIADGGLRYSGDVVKALAAGGY
CVMIGSLVAGTEESPGDTIIFNGRKFKSYRGMGSLEAMENGSKDRYFQSGTADVKKLVPE
GIAARVPYKGTLYEVVYQLSGGLRAGMGYCGAANIEKLHDAKFTRITNAGVMESHPHDVT
ITSESPNYSRPE