Protein Info for BT3836 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative phosphoglycerate dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 435 (432 residues), 538.9 bits, see alignment E=1.5e-165 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 106.1 bits, see alignment E=7.6e-34 amino acids 178 to 295 (118 residues), 90.6 bits, see alignment E=5e-29 PF02421: FeoB_N" amino acids 5 to 125 (121 residues), 63.1 bits, see alignment E=1.5e-20 amino acids 178 to 340 (163 residues), 42.2 bits, see alignment E=4e-14 PF00009: GTP_EFTU" amino acids 5 to 163 (159 residues), 32.3 bits, see alignment E=4.9e-11 amino acids 251 to 346 (96 residues), 47.8 bits, see alignment E=8.9e-16 TIGR00231: small GTP-binding protein domain" amino acids 5 to 153 (149 residues), 78.7 bits, see alignment E=6.5e-26 amino acids 178 to 316 (139 residues), 77 bits, see alignment E=2.2e-25 PF04548: AIG1" amino acids 6 to 109 (104 residues), 30.3 bits, see alignment E=1.8e-10 PF14714: KH_dom-like" amino acids 354 to 435 (82 residues), 92.8 bits, see alignment E=8.2e-30

Best Hits

Swiss-Prot: 100% identical to DER_BACTN: GTPase Der (der) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to bth:BT_3836)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A135 at UniProt or InterPro

Protein Sequence (437 amino acids)

>BT3836 putative phosphoglycerate dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNNLVAIVGRPNVGKSTLFNRLTKTRQAIVNEEAGTTRDRQYGKSEWLGREFSVVDTGGW
VVNSDDIFEEEIRKQVLLAVEEADVILFVVDVMNGVTDLDMQVATILRRANSPVIMVANK
TDNNELQYNAPEFYKLGLGDPYCISAITGSGTGDLMDLIVSKFNKETSEILDDDIPRFAV
VGRPNAGKSSIVNAFIGEDRNIVTEIAGTTRDSIYTRYNKFGFDFYLVDTAGIRKKNKVN
EDLEYYSVVRSIRSIENADVCILMLDATRGVESQDLNILSLIQKNQKGLVVVINKWDLIE
DKTAKMMKEFEATIRSRFAPFVDFPIIFASALTKQRILKVLEEARNVYENRTTKIPTARL
NEEMLPLIEAYPPPSNKGKYIKIKYITQLPNTQVPSFVYFANLPQYVKEPYKRFLENKMR
EKWNLTGTPINIYIRQK