Protein Info for BT3815 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 53 to 69 (17 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details TIGR03426: rod shape-determining protein MreD" amino acids 11 to 156 (146 residues), 79 bits, see alignment E=1.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3815)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A152 at UniProt or InterPro

Protein Sequence (165 amino acids)

>BT3815 hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIITYIHRIGWFIGLVLLQVLILNNVHIAGYATPFLYIYFILKFASGTSRNELMLWAFFF
GLTIDIFADTPGMNAAATVLLAFLRPSLLRLFTPRDNLDSIIPSFKSMGITPFLKYTTAS
VFVHSLALLSIEFFSFTSIWLLLLRVISCTLLTLTCILAVEGIRR