Protein Info for BT3804 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative transport protein, multidrug efflux protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 353 to 370 (18 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details PF01554: MatE" amino acids 21 to 180 (160 residues), 91.3 bits, see alignment E=2.8e-30 amino acids 247 to 407 (161 residues), 97.9 bits, see alignment E=2.6e-32 TIGR00797: MATE efflux family protein" amino acids 21 to 421 (401 residues), 249.1 bits, see alignment E=3.6e-78

Best Hits

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to bth:BT_3804)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A163 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BT3804 putative transport protein, multidrug efflux protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRNIYSIYKEHYKALISLGLPIVIGQIGVIVLGFADTLMIGHHSTIELGAASFVNNVFNL
VIIFSTGFSYGLTPIVGGLYGTHQYASAGQALRNSLLANLLVAFLLTIGMTVLYFNVGNL
GQPEELIPLIKPYYLVLLASLVFVMLFNGFKQFTDGITDTKTAMWILLGGNVLNIIGNYI
LIYGKLGLPEMGLLGAGISTLFSRIMMVVVFIIVFMRSPRFLRFKLGFYRLGWSKAIFGR
LNSLGWPIAFQMGMETASFSLSAVMIGWLGTIALASHQVMLAISQFTFMMYYGMGAAVAV
RVSNFNGQGDILNVRRSAYAGFHLMMALGVVLSSIVFLCRNYLGGWFTDSTEVAAMVTSL
ILPFLVYQFGDGLQITFANALRGISDVKLMMLIAFIAYFLISLPVGYFCGFVLEWGIIGV
WMAFPFGLTSAGLMLWWRFHHKTKLPPSIQNS