Protein Info for BT3702 in Bacteroides thetaiotaomicron VPI-5482

Name: SusC
Annotation: SusC, outer membrane protein involved in starch binding (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1003 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR04056: TonB-linked outer membrane protein, SusC/RagA family" amino acids 29 to 1003 (975 residues), 887.8 bits, see alignment E=1.2e-270 PF13620: CarboxypepD_reg" amino acids 30 to 89 (60 residues), 43 bits, see alignment 9.8e-15 PF13715: CarbopepD_reg_2" amino acids 31 to 109 (79 residues), 66.3 bits, see alignment 4.2e-22 PF07715: Plug" amino acids 117 to 232 (116 residues), 73 bits, see alignment E=5.5e-24 TIGR04057: TonB-dependent outer membrane receptor, SusC/RagA subfamily, signature region" amino acids 208 to 238 (31 residues), 62.8 bits, see alignment (E = 1.9e-21) PF00593: TonB_dep_Rec_b-barrel" amino acids 393 to 783 (391 residues), 70.2 bits, see alignment E=6.8e-23

Best Hits

Swiss-Prot: 100% identical to SUSC_BACTN: TonB-dependent receptor SusC (susC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 100% identity to bth:BT_3702)

Predicted SEED Role

"SusC, outer membrane protein involved in starch binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1G1 at UniProt or InterPro

Protein Sequence (1003 amino acids)

>BT3702 SusC, outer membrane protein involved in starch binding (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKGNFMFKVLLMLIAGIFLSIDAFAQQITVKGIVKDTTGEPVIGANVVVKGTTTGTITD
FDGNFQLSAKQGDIIVVSFIGYQPQELPVAAQMNVILKDDTEILDEVVVIGYGQVKKNDM
TGSVMAIKPDELSKGITTNAQDMLSGKIAGVSVISNDGTPGGGAQIRIRGGSSLNASNDP
LIVIDGLAIDNEGIKGMANGLSMVNPADIETLTVLKDASATAIYGSRASNGVIIITTKKG
KNGQAPSVSYNGSVSFSKTQKRYDVLSGDEYRAYANQLWGDKLPADLGTANTDWQDQIFR
TAVSTDHHVSINGGFKNLPYRVSLGYTDDNGIVKTSNFRRFTASVNLAPSFFEDHLKFNI
NAKFMNGKNRYADTGAAIGGALAIDPTRPVYSNEDPYQFTGGYWQNINSTTGFSNPDWKY
TSNPNSPQNPLAALELKNDKANSNDFVGNVDVDYKFHFLPDLRLHASIGGEYAEGTQTTI
VSPYSFGNNYYGWNGDVTQYKYNLSYNIYVQYIKSLGANDFDIMVGGEEQHFHRNGFEEG
QGWDSYTQEPHDAKLREQTAYATRNTLVSYFGRLNYSLLNRYLFTFTMRWDGSSRFSKDN
RWGTFPSLALGWKIKEENFLKDVNVLSDLKLRLGWGITGQQNIGDDFAYLPLYVVNNEYA
QYPFGDTYYSTSRPKAFNENLKWEKTTTWNAGLDFGFLNGRITGGIDGYFRKTDDLLNSV
KIPVGTNFNAQMTQNIGSLENYGMEFSINAKPIVTKDFTWDLSYNITWNHNEITKLTGGD
DSDYYVEAGDKISRGNNTKVQAHKVGYAANSFYVYQQVYDENGKPIENMFVDRNGNGTID
SGDKYIYKKPAGDVLMGLTSKMQYKNFDFSFSLRASLNNYVYYDFLSNKANVSTSGLFSN
NAYSNTSAEAVALGLSGQGDYMSDYFIHNASFLRCDNITLGYSFQNLWKTQTYKGVGGRV
YATVQNPFIISKYKGLDPEVKSGIDANPYPRAMTFLLGLSLQF