Protein Info for BT3699 in Bacteroides thetaiotaomicron VPI-5482

Name: SusF
Updated annotation (from data): SusF: Outer membrane amylopectin-binding protein
Rationale: Specifically important in carbon source amylopectin from maize. It is part of the starch utilization system (Sus) and binds starch (PMCID:PMC3464567). Given the phenotypic information, it probably binds specifically to the amylopectin part of starch.
Original annotation: outer membrane protein SusF (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF17142: DUF5115" amino acids 20 to 273 (254 residues), 443.2 bits, see alignment E=4.2e-137 PF16411: SusF_SusE" amino acids 280 to 484 (205 residues), 59.9 bits, see alignment E=4e-20

Best Hits

Swiss-Prot: 100% identical to SUSF_BACTN: Outer membrane protein SusF (susF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 100% identity to bth:BT_3699)

Predicted SEED Role

"Outer membrane protein SusF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8JZS6 at UniProt or InterPro

Protein Sequence (485 amino acids)

>BT3699 SusF: Outer membrane amylopectin-binding protein (Bacteroides thetaiotaomicron VPI-5482)
MKKHLIYTGMFLAAIGFSACNEDFKDWADPQSNPQEESAGQLTATFTAGKDASIVMDAAT
ADSVEIAKLSSTTAEEGSKIAVNSLTLNENHTIPFSMTEDHVFKVALAQLDSVTQEAYKS
RASVVRELKISINASAVTPSGEGIQLVGNEVSITLQPATTPAVDPDGYYIVGDFTGWDGN
SAQQMKKDALDENLYILEAEIESTSNFKIFPASAINGNDIDWTKALGSSVDGDDSGDNFV
SWTNAGAINTALDGKIKISFDAFNYRFTVKDNSAPTELYMTGSAYNWGTPAGDPNAWKAL
VPVNGTKGTFWGIFYFAANDQVKFAPQANWGNDFGFVDAISQESKDLAGLSDEGGNLKVG
IAGWYLVYVSVIGDDKVIEFEKPNVYLMGDTSYNGWDAQLVEQDLFTVPGTADGEFVSPA
FLKDGAVRICVNPKAVSAGDWWKTEFIIFDGQIAYRGNGGDQAAVQGKTGQKVYLNFGNG
TGRIE