Protein Info for BT3692 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphate acetyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF01515: PTA_PTB" amino acids 4 to 329 (326 residues), 393 bits, see alignment E=6.1e-122 TIGR00651: phosphate acetyltransferase" amino acids 19 to 329 (311 residues), 359.1 bits, see alignment E=1.2e-111

Best Hits

Swiss-Prot: 53% identical to PTAS_CLOAB: Phosphate acetyltransferase (pta) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K00625, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 100% identity to bth:BT_3692)

MetaCyc: 53% identical to phosphate acetyltransferase (Clostridium kluyveri)
Phosphate acetyltransferase. [EC: 2.3.1.8]

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1G9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>BT3692 phosphate acetyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLNLINQIVARAKADRQRIVLPEGTEERTLKAANQILTDEVADLILLGKPAEINELAVKW
GLGNISKATIIDPETSPKHEEYAQLLCELRKKKGMTIEEARQLTNDPLFYGCLMIKSGDA
DGQLAGARNTTGNVLRPALQIIKTAPGITCVSGAMLLLTHAPEYGKNGILVMGDVAVTPV
PDPNQLAQIAVCTAQTAKAVAGIENPKVAMLSFSTKGSAKHEVVDKVVEATKIAKEMAPT
LDLDGEMQADAALVPEVGASKAPGSPVAGEANVLIVPSLEVGNISYKLVQRLGHADAIGP
ILQGIARPVNDLSRGCSIEDVYRMIAITANQAIAAKNNK