Protein Info for BT3638 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+/H+ anti-porter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 20 to 391 (372 residues), 175.2 bits, see alignment E=1.9e-55 PF00582: Usp" amino acids 416 to 544 (129 residues), 26.5 bits, see alignment E=8.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3638)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1M3 at UniProt or InterPro

Protein Sequence (711 amino acids)

>BT3638 Na+/H+ anti-porter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNLFEFNLALPITDPTWVFFLVLIIILFAPMILGRLHIPHIIGMILAGVLIGEHGFHVLD
RDSSFELFGKVGLYYIMFLAGLEMDMEDFKKNRMKSVVFGLLTFLIPMALGIWSSMSMLG
YGFLTAVLLASMYASHTLIAYPIISRYGLSRLRSVNITIGGTAITVTLALIILAVIGGMF
KGTVDGLFWVFLVAKVAFLGFLIIFFFPRIGRWFFRKYDDSVMQFVFVLAMVFLGGGLME
FVGMEGILGAFLAGLVLNRLIPHVSPLMNRLEFVGNALFIPYFLIGVGMIIDVRSLFTGG
EALKVAVVMTVVATFSKWLAAWITQKIYRMQPNERSMIFGLSNAQAAATLAAVLIGHEII
MENGERLLNDDVLNGTVVMILFTCVISSLVTERSARRFALNEDAQPEDKGAKKAMEQILI
PVANPETIENLVNLALVIKDAKQKNGMIALNVINDNNSSENKELQGKRNLEKAAMIAAAA
DVPVTMVSRYDLNIASGIIHTIKEYEATDVVIGLHRKANIVDSFFGNLAESLLKGTHREV
MIAKFLMPVNTLRRIIIAVPPKAEFETGFSKWVEHFCRMGSILGCRVHFFANERTLMRLQ
QLVKKKFSGTPTEFSLLEEWGDLLLLTGQVNYDHLFVVISARRGSISYDPSFERLPAQLS
KYFSNNSLIILYPDQFGDPQEIVSFSDPRGYNESQHYEKVGKWFYKWFKKS