Protein Info for BT3623 in Bacteroides thetaiotaomicron VPI-5482

Annotation: sodium/iodide co-transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 320 to 348 (29 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 429 to 446 (18 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details PF00474: SSF" amino acids 33 to 424 (392 residues), 97.8 bits, see alignment E=3.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3623)

Predicted SEED Role

"sodium/iodide co-transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1N6 at UniProt or InterPro

Protein Sequence (495 amino acids)

>BT3623 sodium/iodide co-transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSPIILSITIIAYFMILFAISYIAGHKADNEGFFVGNRKSAWYIVAFAMIGSTISGVTFV
SVPGMVQASGFSYLQMVLGFIVGQFIIAFILVPLFYRMNLVSIYEYLENRFGASSYKTGA
WFFFISKMLGAAVRLFLVCLTLQLLIFEPFHIPFIINVILTVLIVWLYTFRGGVKSLIWT
DVLKTFCLVVSVVLCIYYIASSLHLNFSGLVSTISDNDLSKMFFFDDVNDKRYFFKQFLA
GVFTVIAMNGLDQDMMQRNLSCKNFRDSQKNMITSGISQFFVILLFLMLGVLLYTFTARQ
GIENPGKSDELFPMIATGNYFPGIVGILFIIGLIASAYSAAGSALTALTTSFTVDILNAH
KKDEAALSKIRKHVHIGMAFVMGIVIFVFNLLNNTSVIDAIYTLASYTYGPILGLFAFGI
FTKKQVYDPYIPLVAILSPALCYVLQRNSEAWFDGYQISYELLILNAAFTFLGLCLLIKR
KSSVAPINNSLIKKH