Protein Info for BT3555 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 372 to 397 (26 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details PF13194: DUF4010" amino acids 188 to 399 (212 residues), 191 bits, see alignment E=1.1e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3555)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1V3 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BT3555 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEQLYNYLPRELITFVLVTLFSLLIGLSQRRISLKREGETTLFGTDRTFTFIGILGYLLY
ILDPTDMRLFMGGGAVLGLLLGLNYYVKQSQFHVFGVTTIIIALITYCLAPIVSTQPSWF
YVMVIVTVLLLTELKHTFTEFAQRMKNDEMITLAKFLAISGIILPMLPHKNLIPDINLTP
YSIWLATVVVSGISYLSYLLKRYVFHESGVLVSGIIGGLYSSTATISVLARKSRKASEQE
ANEYVAAMLLAVSMMFLRFMILILIFSREIFTSIYPYLLIMSVVAAVVAWFIHSRHRRSK
DMADESEDEDSSNPLEFKVALIFATLFVVFTVLTHYTLVYAGTGGLNLLSFVSGLSDITP
FILNLLQNTGSVAVLVVVACSMQAIISNILVNMFYALFFAGKGSKLRPWILGGFGTVIGV
NLVLLLFFYL