Protein Info for BT3533 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 130 to 146 (17 residues), see Phobius details amino acids 152 to 168 (17 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 137 to 285 (149 residues), 73.8 bits, see alignment E=6.6e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3533)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1X5 at UniProt or InterPro

Protein Sequence (537 amino acids)

>BT3533 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKSIPVSSILYFLLSLGVLFVNANTFTDSQIFPKWMFMFTGLGVIGCFFSFYLFRGKRFI
CNAKCCYYTVIISCFLQAGYGILQFFNILSSHSITYNVVGSFDNPAGFAGSLCAGLPFTF
YFLQYSNKKVQWASWCALFVIVLGVLLSESRAGSISIFTVLVIYFIHQNKNKFHYKKHIG
SFLLCLSFLLISIFVISVTVYHLKKDSADGRLLIWRCTWEMIKHEPFTGYGVGGFSAHYM
DYQAQYFKEHPDSQFAILADNIKSPFNEYLSVGVQFGILTWVLLIAAGIFLILCHRKHPT
KAGYVSLLSLLSIAVFSFFSYPFTYPFIWIISALSVSTLIGKAYENTLFQKTTIIKRGIA
FFLLIGSLFLLIEVVSRIKAELEWGKVAHMSLCGRTNDMLPRYHNLLHTFRRNPYFLYNY
SAELCVAEKYKECLAITAICCNYWSDYNLELVQAEAYIGLKQYDAAKHHLEKATLMCPVR
FIPLYRLHYVYMKQGKAEKANRLAQLIIEKPIKKNSTIIQKIKAEMKHHLSRKTCLY