Protein Info for BT3493 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative outer membrane protein, probably involved in nutrient binding (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 30 to 99 (70 residues), 34.7 bits, see alignment E=2.8e-12 PF13715: CarbopepD_reg_2" amino acids 30 to 112 (83 residues), 56.4 bits, see alignment E=3.9e-19 PF07715: Plug" amino acids 121 to 226 (106 residues), 64.6 bits, see alignment E=1.7e-21 TIGR04057: TonB-dependent outer membrane receptor, SusC/RagA subfamily, signature region" amino acids 202 to 232 (31 residues), 67.2 bits, see alignment 4.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3493)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A215 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BT3493 putative outer membrane protein, probably involved in nutrient binding (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNNMKKYLSLCIMLLCLCSTVMAQQEKVVVKGVVTDEAKEPLIGVNVTVKDMPGLGSITD
MNGHYSITMEPYRQLVFTYIGYESKEVMVKEQRTINVVMKESVTRAVDEVVITGTGVQRK
LTQTGAITTVDVGELKRNPSSSIVNALAGNVPGIMARQTSGQPGKNISEFWIRGISTFGA
NSSAYVLVDGFERSMDEINIEDIETFTVLKDASATAIYGSKGANGVVLITTKRGKAGKIK
IDAKVETTYNTRTVLQSSKTDLLMPA