Protein Info for BT3451 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phospho-N-acetylmuramoyl-pentapeptide-transferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 279 to 296 (18 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 101 to 324 (224 residues), 91.5 bits, see alignment E=3e-30 TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 207 to 422 (216 residues), 193.7 bits, see alignment E=2.7e-61

Best Hits

Swiss-Prot: 100% identical to MRAY_BACTN: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 100% identity to bth:BT_3451)

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A255 at UniProt or InterPro

Protein Sequence (422 amino acids)

>BT3451 phospho-N-acetylmuramoyl-pentapeptide-transferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLYYLFEWLHKLNFPGAGMFGYTSFRALMAVILALLISSIWGDKFINLLKKKQITETQRD
AKTDPFGVNKVGVPSMGGVIIIVAILIPCLLLGKLDNIYMILMLITTVWLGSLGFADDYI
KIFKKDKEGLHGKFKIIGQVGLGLIVGLTLYLSPDVVIRENIEVHTPGQEMEVIHGTNDL
KSTQTTIPFFKSNNLDYADLVGFMGEHAQTAGWFLFVIITIFVVTAVSNGANLNDGMDGM
AAGNSAIIGATLGILAYVSSHIEFASYLNIMYIPGSEELVIYICAFIGALIGFLWYNAYP
AQVFMGDTGSLTIGGIIAVFAIIIHKELLIPILCGVFLVENLSVILQRFYYKIGKRKGVK
QRLFKRTPIHDHFRTSMSLVEPGCTVKFTKPDQLFHESKITVRFWIVTIVLAAITIITLK
IR