Protein Info for BT3358 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase II (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR03150: beta-ketoacyl-acyl-carrier-protein synthase II" amino acids 4 to 416 (413 residues), 619.3 bits, see alignment E=1.3e-190 PF00109: ketoacyl-synt" amino acids 4 to 249 (246 residues), 191.6 bits, see alignment E=1.9e-60 PF02801: Ketoacyl-synt_C" amino acids 257 to 371 (115 residues), 134.4 bits, see alignment E=1.9e-43

Best Hits

Swiss-Prot: 50% identical to FABF_COXBU: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 100% identity to bth:BT_3358)

MetaCyc: 55% identical to beta-ketoacyl-acyl carrier protein synthase II (Bacillus subtilis subtilis 168)
Beta-ketoacyl-acyl-carrier-protein synthase II. [EC: 2.3.1.179, 2.3.1.41]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.41)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.179 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2E7 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BT3358 3-oxoacyl-[acyl-carrier-protein] synthase II (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MELKRVVVTGLGAITPVGNDVPEFWENLVNGVSGAGPITHFDASQFKTQFACEVKNFDVT
KYIDRKEARKMDLYTQYAVAVAKEAVSDSGLDVEKEDLNRIGVIFGAGIGGIHTFEEEVG
NYYTHQEIGPKFNPFFIPKMISDIAAGQISIMYGFHGPNYATCSACATSTNAIADAFNLI
RLGKANVIVSGGSEAAIFPAGVGGFNAMHALSTRNDEPSKASRPFSASRDGFIMGEGGGC
LILEELEHAKARGAKIYAEVAGVGMSADAHHLTASHPEGLGAKLVMLNALEDAEMDPKEV
DYINVHGTSTPVGDISEAKAIKEVFGDHAYELNISSTKSMTGHLLGAAGAVESIASILAI
KNGIVPPTINHEEGDNDENIDYDLNFTFNKAQKREVNVALSNTFGFGGHNACVIFKKYAE