Protein Info for BT3357 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ribonuclease III (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR02191: ribonuclease III" amino acids 38 to 253 (216 residues), 207.5 bits, see alignment E=9.4e-66 PF14622: Ribonucleas_3_3" amino acids 47 to 173 (127 residues), 111.3 bits, see alignment E=5.7e-36 PF00636: Ribonuclease_3" amino acids 72 to 158 (87 residues), 79.2 bits, see alignment E=5.4e-26 PF00035: dsrm" amino acids 188 to 252 (65 residues), 57.9 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 100% identical to RNC_BACTN: Ribonuclease 3 (rnc) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to bth:BT_3357)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2E8 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BT3357 ribonuclease III (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRALSSRNTLSKIVLRNQIDKIRLLFRKDRESYLCFYRILGFYPHNIQIYEQALLHKSSA
VRSEKGRPLNNERLEFLGDAILDAIVGDIVYKRFEGKREGFLTNTRSKIVQRETLNKLAV
EIGLDKLIKYSTRSSSHNSYMYGNAFEAFIGAIYLDQGYERCKQFMEQRIINRYIDLDKI
SRKEVNFKSKLIEWSQKNKMEVSFELIEQFLDHDSNPVFQTEVRIEGLPAGTGTGYSKKE
SQQNAAQMAIKKVKDQTFMDTVNEAKSQHSKPSEVETESVEPELTESETMEPDTLETEAP
EAETTADKVETTVNEVEATETEKE