Protein Info for BT3337 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): RND efflux system, outer membrane component BipA
Rationale: Specifically important in stress Fusidic acid sodium salt; stress Chlorpromazine hydrochloride; stress Bile salts; stress Thioridazine hydrochloride; stress Rifampicin; stress Cefoxitin sodium salt. This protein belongs to the NodT family of outer membrane exporters. It is unclear if this system is an efflux pump for hydrophobic compounds, as suggested by many of its phenotypes, or an efflux pump for magnesium (PMC11078008), which apparently reduces biofilm formation and might alter susceptibility to those compounds.
Original annotation: outer membrane protein oprM precursor, multidrug resistance protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 10 to 458 (449 residues), 264.4 bits, see alignment E=9.8e-83 PF02321: OEP" amino acids 70 to 250 (181 residues), 68 bits, see alignment E=4.5e-23 amino acids 276 to 457 (182 residues), 104 bits, see alignment E=4.1e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3337)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2G8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BT3337 RND efflux system, outer membrane component BipA (Bacteroides thetaiotaomicron VPI-5482)
MKKQILYMLCATALLSSCHIYKSYDRPEDITASGLYRDPAADNDTLASDTTNFGNLPWRE
VFTDPQLQSLIEQGLKQNTDLLSAALNVKAAEASLMSARLAYAPSIGLSPQGTISSFDKN
AATKTYSLPVTASWQVDLFGQLLNSKRNAQVTLKQTKAYRQAVQTQVIANIANMYYTLLM
LDRQLEITQATAEVLKRNAETVQALSERSTYTSAALAQSKAAYAQVVASIPDIEQSIRET
ENALSTFLGEAPHAIKRGVLEAQALPEELSAGIPLQLLSNRPDVKAAEMSLASCYYNTNS
ARAAFYPQITLSGSAGWTNSAGSAIINPGKLLASAIGSLTQPLFYRGTNIARLKAAKAQE
EQAKLSFQQTLYNAGSEVSNALSLYQNTSKKAESRQMQVESAKKASEDTKELFNLGTSTY
LEVLSAQQSYLSAQISQVSDCFDKMQAVVSLYQALGGGRED