Protein Info for BT3336 in Bacteroides thetaiotaomicron VPI-5482

Annotation: UDP-N-acetylglucosamine acetyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase
  • amino acids 2 to 255 (254 residues), 265.6 bits, E=1.9e-83
• PF00132: Hexapep
  • amino acids 12 to 41 (30 residues), 29.1 bits, 5.7e-11
  • amino acids 29 to 63 (35 residues), 31.4 bits, 1.1e-11
• PF13720: Acetyltransf_11
  • amino acids 173 to 255 (83 residues), 82.2 bits, E=3e-27

Best Hits

Swiss-Prot: 40% identical to LPXA_HALHL: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Halorhodospira halophila (strain DSM 244 / SL1)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to bth:BT_3336)

MetaCyc: 39% identical to acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase monomer (Porphyromonas gingivalis W50)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]; 2.3.1.129 [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (11/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (11/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.129

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

See Q8A2G9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BT3336 UDP-N-acetylglucosamine acetyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MISPLAYVDPEAKLGKNVTVLPFAYIEKDVEIGDDCTIMSYASILKGTKMGKGNKIHQNA
VLGAEPQDFHYTGEESSLIIGDNNDIRENVVISRATFAGNATRIGNGNYLMDKVHLCHDV
QISNNCVVGIGTTIAGECSLDDCVILSGNVTLHQYCHIGSWTLVQSGCRISKDVPPYVIM
SGNPVAYHGVNAVVLSQHHNTSERILRHIANAYRLIYQGNFSVQDAVQKIIDQVPMSEEI
ENIVNFVKGSERGIVK