Protein Info for BT3305 in Bacteroides thetaiotaomicron VPI-5482

Annotation: fructokinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 100% identity to bth:BT_3305)

Predicted SEED Role

"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)

MetaCyc Pathways

heterolactic fermentation (14/18 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
sucrose degradation III (sucrose invertase) (3/4 steps found)
sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
D-sorbitol degradation I (2/3 steps found)
sucrose degradation II (sucrose synthase) (3/5 steps found)
sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
mannitol cycle (2/5 steps found)
sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2K0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BT3305 fructokinase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRKVIGIGETILDIIFRGNQPSAAVPGGSVFNGIVSLGRMGIKVGFISETGNDRVGNIIL
QFMRENNIPTDHVNVFPDGKSPVSLAFLNEQSDAEYIFYKDYPKQRLDVLYPKLEEDDIV
MVGSYYALNPVLREKILELLDQAREKKAIIYYDPNFRSSHKNEAMKLAPTIIENLEYADI
VRGSLEDFFYMYGLQDVDKIYKDKIKFYCPRFICTAGGDKVSLRTNLVSKEYPIEPLEAV
STIGAGDNFNAGLIYGLLKYDVRYRDLNNLNEEVWDKVVQCGKDFAAEVCRSFSNSVSVE
FAGQYASK