Protein Info for BT3254 in Bacteroides thetaiotaomicron VPI-5482

Annotation: dipeptidyl peptidase IV (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00930: DPPIV_N" amino acids 115 to 450 (336 residues), 270.8 bits, see alignment E=2.8e-84 PF07676: PD40" amino acids 183 to 204 (22 residues), 12.5 bits, see alignment (E = 2.4e-05) PF00326: Peptidase_S9" amino acids 538 to 732 (195 residues), 149.7 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3254)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2Q1 at UniProt or InterPro

Protein Sequence (732 amino acids)

>BT3254 dipeptidyl peptidase IV (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKIGKRAILILLALPIGFNVMAQEIKKLTLEDLIPGGETYRYAENLYGLQWWGDVCIKP
STDTIYTVQPRTGKETVLTTLGQINKVLADNKAGKLPTPYSIRYPWADKPQMLLKVSGKY
IVYDFENNRIVSTLKLKDKAANEDYCVANGNVAYTVNNNLYVNEQAITDEPEGIVCGQSV
HRNEFGINKGTFWSPKGNLLAFYRMDESMVTQYPLVDITARVGEVNNVRYPMAGMTSHQV
KVGVYNPSTGKTIYLNAGDPTDRYFTNISWSPDEKSIYLIELNRDQNHAVLCQYDATTGK
LLSKLLEETHPKYVEPQHPIVFLPWDSSKFIYQSQRDGYNHLYLCDLTSSLKGEWKSDAA
GGKHIEYIPTKQLTEGKWLVGDILGFNAKRKEVIFQGVDGTGSNNFAVNVNTGKCSLPFS
FRSITEGEHNGMLSASGSYLIDRYSTPTLPRRIDIVDTKSLKTVNLLTAKDPYEGYEMPT
IETGTIKADDGTTDLYYRLTKPADFDPNKKYPVIVYVYGGPHAQLVTGGWLNGSRGWDIY
MANKGYIMFTLDNRGSANRGLEFENATFRRLGIEEGKDQVKGIEFLKSLPYIDGNRIGVH
GWSFGGHMTTALLLRYPEIFKVGVAGGPVIDWGYYEVMYGERYMDTPESNPEGYKECNLK
NLAGQLKGHLLIIHDDHDDTCVPQHTLSFMKACVDARTYPDLFIYPCHKHNVSGRDRVHL
HEKITRYFEQNL