Protein Info for BT3231 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF04962: KduI" amino acids 40 to 265 (226 residues), 83.1 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 100% identical to KDUI1_BACTN: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1 (kduI1) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01815, 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC: 5.3.1.17] (inferred from 100% identity to bth:BT_3231)

MetaCyc: 47% identical to 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase subunit (Dickeya dadantii 3937)
4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase. [EC: 5.3.1.17]

Predicted SEED Role

"4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 5.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.17

Use Curated BLAST to search for 5.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2S4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>BT3231 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKTNYEIRYAAHPEDAKSYDTARIRRDFLIEKIFVPNEVNMVYSMYDRMVVGGALPVGEV
LTLEAIDPLKAPFFLTRREMGIYNVGGPGVVKAGDAVFELDYKEALYLGSGDRVVTFESK
DASNPAKFYFNSLTAHRNYPDRKVTKADAVVAEMGSLEGSNHRNINKMLVNQVLPTCQLQ
MGMTELAPGSVWNTMPAHVHSRRMEAYFYFEIPEEHAICHFMGEVDETRHVWMKGDQAVL
SPEWSIHSAAATHNYTFIWGMGGENLDYGDQDFSLITDLK