Protein Info for BT3228 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 signal peptide" amino acids 12 to 21 (10 residues), see Phobius details transmembrane" amino acids 22 to 38 (17 residues), see Phobius details PF01809: YidD" amino acids 26 to 90 (65 residues), 108.5 bits, see alignment E=5.8e-36 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 29 to 91 (63 residues), 86.9 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 100% identical to YIDD_BACTN: Putative membrane protein insertion efficiency factor (BT_3228) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K08998, hypothetical protein (inferred from 100% identity to bth:BT_3228)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2S7 at UniProt or InterPro

Protein Sequence (91 amino acids)

>BT3228 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKPRAHRVSVCWMSLKSLVRKVFSFLLLIPIYFYRVCISPLTPPSCRFTPTCSAYAVEAI
KKHGPVKGLYLAVRRILRCHPWGGSGYDPVP