Protein Info for BT3209 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13489: Methyltransf_23
  • amino acids 64 to 218 (155 residues), 93.4 bits, E=3.3e-30
• PF13847: Methyltransf_31
  • amino acids 81 to 179 (99 residues), 27.7 bits, E=5.3e-10
• PF08242: Methyltransf_12
  • amino acids 86 to 173 (88 residues), 46 bits, E=1.9e-15
• PF08241: Methyltransf_11
  • amino acids 86 to 175 (90 residues), 46.7 bits, E=1.1e-15
• PF13649: Methyltransf_25
  • amino acids 86 to 171 (86 residues), 38.1 bits, E=5.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3209)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (4/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (1/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (1/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (1/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (1/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (1/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (1/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (1/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (1/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (1/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (1/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (1/11 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

See Q8A2U6 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BT3209 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTCTDFYASGEQFELCSCEDCGFTFTQGVPVEAEIGKYYETPDYISHTDTRKGAMNTIYH
YVRSYMLGRKARLVAREAHRKRGRLLDIGTGTGYFADTMARRGWKVEAVEKSPQARAFAK
EHFDLDVKPESALKEFAPGSFDVITLWHVMEHLEHLNETWEMLRELLTEKGMLIVAVPNC
SSYDAGRYGEYWAAYDVPRHLWHFTPVTIQQLASRHGFIMAARHPMPFDAFYVSMLSEKH
RGSSCSFLKGMYAGTLAWFSTLGRKERSSSMIYVFRKKR