Protein Info for BT3181 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative sulfate transporter, permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 22 to 47 (26 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 74 to 90 (17 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 387 to 416 (30 residues), see Phobius details TIGR00815: sulfate permease" amino acids 12 to 548 (537 residues), 383.8 bits, see alignment E=6.7e-119 PF00916: Sulfate_transp" amino acids 22 to 391 (370 residues), 296.3 bits, see alignment E=2.9e-92 PF01740: STAS" amino acids 450 to 545 (96 residues), 51.7 bits, see alignment E=6.8e-18

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to bth:BT_3181)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2X4 at UniProt or InterPro

Protein Sequence (559 amino acids)

>BT3181 putative sulfate transporter, permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKLFEFKPKLVSCLKNYSKETFMADLMAGVIVGIVALPLAIAFGIASGVSPEKGIITAII
AGFIISLLGGSKVQIGGPTGAFIVIIYGIIQQYGEAGLIVATLMAGVLLILLGVFKLGAV
IKFIPYPIIVGFTSGIAVTIFTTQIADIFGLSFGGEKVPGDFVGKWMIYFRHFDTVNWWN
TIVSIVSIIIIAITPRFSKKIPGSLIAIIVVTVAVYLMKTYGGIDCIPTIGDRFTIKSEL
PDAVVPALDWEAIKNLFPVAITIAVLGAIESLLSATVADGVIGDRHDSNTELIAQGAANI
VAPLFGGIPATGAIARTMTNINNGGKTPIAGIIHAIVLLLILLFLMPLAQYIPMACLAGV
LVIVSYNMSGWRVFKALLKNPKSDVTVLLITFFLTVIFDLTVAIEVGLIIACVLFMKRVM
ETTEISVITDEIDPNKESDIAVNEENIMIPKGVEVYEITGPYFFGIATKFEETMAQLGDR
PNVRIIRMRKVPFIDSTGIHNLTTLCEMSQKEKITVILSGVNEKVYKVLEKSGFYELLGK
ENICPNFKIALDRAEEVMK