Protein Info for BT3180 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3180)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2X5 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BT3180 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNKLSEKNTTRLASLDILRGFDLFLLVFFQPVFAALVRQLNLPFLNDILYQFDHEVWEGF
RFWDLVMPLFLFMTGASMPFSLSKYVGMSGSYWLVYRRILRRVFLLFIFGMIVQGNLLGL
DSSHIYLYSNTLQSIAVGYLIAAVIQLHFSFRWQIGITLLLLFIYWIPMTFLGDFTPAGN
FAEQVDRCVLGRFRDGVFWNEDGTWSFSPYYNYTWIWSSLTFGVTVMLGAFAGKIMKEGK
ANRKKVVQTLSVIGVLLVGLAMLWSLQMPIIKRLWTGSMTLLSGGYCFLLMALFYYWIDY
KGHSRGLNWLKVYGMNSITAYLLGEVVNFRCIADSVSYGLKQYIGDYYPVWLTFANYLIL
FFLLRMMYKRGLFLKV