Protein Info for BT3113 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative transmembrane efflux protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 347 (25 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 318 (311 residues), 130.5 bits, see alignment E=7.5e-42 PF00083: Sugar_tr" amino acids 41 to 174 (134 residues), 43.8 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 50% identical to ARAJ_ECOLI: Putative transporter AraJ (araJ) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 100% identity to bth:BT_3113)

Predicted SEED Role

"Protein AraJ precursor" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A342 at UniProt or InterPro

Protein Sequence (380 amino acids)

>BT3113 putative transmembrane efflux protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKSLIALAFGTLGLGIAEFVMMGILPDVARDLKISIPAAGHFISAYALGVCVGAPVLTL
ARKYPLKHILLVLVTLIMVGNICAALSPNYWMLLISRFISGLPHGAYFGVGSIVAERLAD
KGKSSEAVSIMIAGMTIANLFGVPLGTSLSTMLSWRATFLLVGLWGIVILYYIWRWVPQV
EGLKDTGFKGQFRFLKTPAPWLILGATALGNGGVFCWYSYINPMLTHISGFSAESITPLM
ILAGFGMVMGNLISGRLSDRYTPGKVGTAAQALICLMLLLIFFLSPYKWAAALLMCLCTA
GLFAVSSPEQILIIRVAKGGEMLGAACVQVAFNLGNAIGAYAGGLAISGGYRYPALTGVP
FALIGFILFLIFYKKYQAKY