Protein Info for BT3100 in Bacteroides thetaiotaomicron VPI-5482

Annotation: lipase, putative esterase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF00135: COesterase" amino acids 58 to 163 (106 residues), 29.2 bits, see alignment E=1.2e-10 PF20434: BD-FAE" amino acids 60 to 174 (115 residues), 71.6 bits, see alignment E=1.8e-23 PF07859: Abhydrolase_3" amino acids 73 to 192 (120 residues), 53.8 bits, see alignment E=6e-18 PF00326: Peptidase_S9" amino acids 201 to 269 (69 residues), 29.9 bits, see alignment E=1e-10 PF01738: DLH" amino acids 210 to 273 (64 residues), 25.8 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3100)

Predicted SEED Role

"probable lipase/esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A355 at UniProt or InterPro

Protein Sequence (291 amino acids)

>BT3100 lipase, putative esterase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRIKLIRCIELKAIVTLSLVLINSGNLLIGSNLFIRDNNDLSADTILRYNHYPTGKLYVY
YSKDQTNQSSPAVIFFFGGGWNSGSPKQFESQASYLNKYGVTVVLADYRTQKNAGTTPKE
ALMDAKSAMRYLKQHAMSIHVDPDKILAGGGSAGGHLAAATAFCHQINNPEDDLNVSSIP
KALILFNPVIDNGPHGYGFDRVKDYYRDFSPIHNIKKDAPPAIFFLGSEDNIVLLETALK
FKKKMEHVGSRCDLLLYPGQKHGFFNAKFEEFFEKTMSATVVFLKSLGYIK