Protein Info for BT3077 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ribonuclease R (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR02063: ribonuclease R" amino acids 22 to 717 (696 residues), 846.6 bits, see alignment E=1.6e-258 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 101 to 716 (616 residues), 519.6 bits, see alignment E=1.1e-159 PF08206: OB_RNB" amino acids 161 to 215 (55 residues), 28.9 bits, see alignment 1.9e-10 PF17876: CSD2" amino acids 166 to 240 (75 residues), 83.8 bits, see alignment E=1.9e-27 PF17849: OB_Dis3" amino acids 172 to 233 (62 residues), 36.2 bits, see alignment 1.3e-12 PF00773: RNB" amino acids 262 to 589 (328 residues), 369 bits, see alignment E=6e-114 PF00575: S1" amino acids 634 to 713 (80 residues), 32.8 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 100% identity to bth:BT_3077)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A378 at UniProt or InterPro

Protein Sequence (718 amino acids)

>BT3077 ribonuclease R (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAKKKEKKEKKAGKRMSKKELAALLIDFFHAKPSETLSMKYIFSELHLTTHPQKMLCADL
LHDLSDDDYISEIEKGKFRLNNHGTEMIGTFQRKSNGKNSFIPEGGGDPIFVAERNSAHA
MNNDKVKITFYAKRKNKDAEGEVIEILERANDTFVGTLEVAKSYAFLVTENRTLANDIFI
PKEKLKGGKTGDKAIVKVTEWPDKAKNPIGQVIDILGVAGDNTTEMHAILAEFGLPYVYP
KAVETAADKIPAEITPEEIARREDFRKVTTFTIDPKDAKDFDDALSIRPIKDGLWEVGVH
IADVTHYVKEGGIIDKEAEKRATSVYLVDRTIPMLPERLCNFICSLRPNEEKLAFSVIFD
ITEKGEVRDSRIVHTVINSDRRFTYEEAQQIIETKTGDFKEEVLMLDTIAKALREKRFAA
GAINFDRYEVKFEIDEKGKPISVYFKESKDANKLVEEFMLLANRTVAEKVGRVPKNKKPK
VLPYRIHDLPDPEKLENLSQFIARFGYKVRTSGTKTDISKSINHLLDDIHGKKEENLIET
VSIRAMQKARYSTHNIGHYGLAFDYYTHFTSPIRRFPDMMVHRLVTKYMDGGRSVSESKY
EDLCDHSSNMEQIAANAERASIKYKQVEFMSERLGQIYDGVISGVTEWGLYVELNENKCE
GMVPIRDLDDDYYEFDEKNYCLRGRRKNKIYSLGDAITIRVARANLEKKQLDFALIEK