Protein Info for BT3074 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF14378: PAP2_3" amino acids 131 to 305 (175 residues), 61.4 bits, see alignment E=1e-20 PF01569: PAP2" amino acids 237 to 314 (78 residues), 32.5 bits, see alignment E=6.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3074)

Predicted SEED Role

"FIG00403590: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A381 at UniProt or InterPro

Protein Sequence (321 amino acids)

>BT3074 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MALDLFKRVETRKGLFAVEKITLIYNLLTSILILFLFQRMDHPWHMLLDRAMIAAMTFLL
MYLYRLAPCKFSAFVRVAIQMSLLSYWYPDTFEFNRFFPNLDHVFAITEQFIFNGQPAIW
FCHTFPHLLVSEAFNMGYFFYYPMMLIVTVFYFIYKFEWFEKMSFVLVTSFFIYYLIYIF
VPVAGPQFYFPAIGFDNVSKGIFPAIGDYFNNNQELLPGPGYQHGFFYSLVEGSQQVGER
PTAAFPSSHVGISTILMIMAWRGSKKLFACLIPFYMLLCGATVYIQAHYVIDAIVGFFSA
FLLYVVATWMFKKWFAQPMFK