Protein Info for BT3034 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphopantetheine adenylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR01510: pantetheine-phosphate adenylyltransferase" amino acids 4 to 147 (144 residues), 169.2 bits, see alignment E=6.8e-54 TIGR00125: cytidyltransferase-like domain" amino acids 4 to 61 (58 residues), 50.1 bits, see alignment E=2.4e-17 PF01467: CTP_transf_like" amino acids 5 to 132 (128 residues), 79.4 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 100% identical to COAD_BACTN: Phosphopantetheine adenylyltransferase (coaD) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 100% identity to bth:BT_3034)

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3C0 at UniProt or InterPro

Protein Sequence (151 amino acids)

>BT3034 phosphopantetheine adenylyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRKAIFPGTFDPFTIGHYSVVERALTFMDEIIIGIGINENKNTYFPIEKREEMIRNLYKD
NPRIKVMSYDCLTIDFAQQVEAQFIVRGIRTVKDFEYEETIADINRKLAGIETILLFTEP
ELTCVSSTIVRELLTYNKDISQFIPEGMEIN