Protein Info for BT2976 in Bacteroides thetaiotaomicron VPI-5482

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerase, outer membrane protein precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF01346: FKBP_N" amino acids 2 to 96 (95 residues), 91.1 bits, see alignment E=6.7e-30 PF00254: FKBP_C" amino acids 103 to 191 (89 residues), 110.1 bits, see alignment E=5.4e-36

Best Hits

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 100% identity to bth:BT_2976)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FklB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3H8 at UniProt or InterPro

Protein Sequence (194 amino acids)

>BT2976 FKBP-type peptidyl-prolyl cis-trans isomerase, outer membrane protein precursor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDKFSYAIGLGIGQNLLSMGAKGIAVDDFAQAIKDVLEGNQTAISHQEAREIVNKYFEEL
EAKMGAAAIEQGKAFLEENKKKPGVVTLPSGLQYEVINEGTGKKAKATDQVKCHYEGTLI
DGTLFDSSIKRGEPAVFGVNQVIPGWVEALQLMPEGSKWKLYIPSDLAYGARGAGEMIPP
HSTLVFEVELLEVL