Protein Info for BT2952 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative outer membrane protein, probably involved in nutrient binding (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 988 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details TIGR04056: TonB-linked outer membrane protein, SusC/RagA family" amino acids 45 to 988 (944 residues), 788.8 bits, see alignment E=1e-240 PF13620: CarboxypepD_reg" amino acids 46 to 108 (63 residues), 40.2 bits, see alignment 7e-14 PF13715: CarbopepD_reg_2" amino acids 46 to 125 (80 residues), 66.2 bits, see alignment E=4.4e-22 PF07715: Plug" amino acids 134 to 243 (110 residues), 56.4 bits, see alignment E=7.8e-19 TIGR04057: TonB-dependent outer membrane receptor, SusC/RagA subfamily, signature region" amino acids 219 to 249 (31 residues), 56.6 bits, see alignment (E = 1.7e-19) PF00593: TonB_dep_Rec_b-barrel" amino acids 422 to 947 (526 residues), 68 bits, see alignment E=3.1e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2952)

Predicted SEED Role

"SusC, outer membrane protein involved in starch binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3K2 at UniProt or InterPro

Protein Sequence (988 amino acids)

>BT2952 putative outer membrane protein, probably involved in nutrient binding (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MENLAISFFERIKEQVTLRTIKYCILMAGFLCVCVPSLYGVENLNVTGKVVDSSGEPLIG
VSIKVENKNMGTTTDINGNFTLADIPKNTVLVLTYIGMETQKVTVTQNRLNIVMRENSVQ
LEEVVAIGYGTVKKEELTSAVTKVGEESFNAGVTTSPINLLNGKVPGLSIRNTSGNDPNA
SPEIHLRGIGSIRAGSAPLIIVDGTYSTMSELQAINANDIKSFNVLKDGSSAAIYGTRGS
NGVIIVETKNASKGKASIEYTSYYYTERPVRKLEMMSADEYMGYLKDKGHSTINNDYGFS
TDWTDQLIRNNFSYYQGVSFSTGTENSSIRGSVGYRDSESMVINTGNKQLTGRVNFKQYF
FDKKLTIEGTLNGANTQSDYTDYGAFMQAIVYHPTAPVYNQEGKFFEYAGVGPYNPVALL
SQVDNRGERYTYSGNLSANLKVLPCLSVYAMMSANNDTYEGSKYISRDSRYSVLGGFEGQ
ADMNTYFYKKRTFEAYANYSFSTDVHNLTALAGYSFNREDRTWHNASNSGFLTDIPGANN
IGNGTYLEDGLASMGRGQDESKLIAFFGRINYSYKGKYLFNASVRREGSTRFGENHKWGW
FPAVSAGWRILEENFFSDATPLSNLKLRVGFGITGNQDIPLYASIAKYNDLGYAYYNGKW
DKVYGPVSNPNPDLKWEKNAEYNAGVDFGIWNDRLTASVDYYYRKTTDLLDWYDAQMPSN
IYSTIFTNVGTLTNQGIEFAIGYDVIRNKELKWHLDGGFSYNENKLVSLANSSYRANHIT
YNPLSSPANGQTTYILEEGKPIGTYYGLKYRGFNSAGKWVFEDRDEDGAYSDKDYTYLGN
GLPKWYFNLASTLTWKDFDFSFQLRGAAGFKVLNTKRIYYENSVSLPFNLLKSALGRPLN
DAATFSDYYLEKGNYLKLDNITVGYTFDLSQLKYVSNARIYATATNLLTITGYTGVDPEV
GTGLTPGFDDSGYYPRSTTLMLGLNIKF