Protein Info for BT2936 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative glycosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 83 to 101 (19 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 88 to 199 (112 residues), 70.7 bits, see alignment E=4.8e-23 PF13579: Glyco_trans_4_4" amino acids 91 to 194 (104 residues), 41.8 bits, see alignment E=4.5e-14 PF20706: GT4-conflict" amino acids 159 to 317 (159 residues), 35.2 bits, see alignment E=2.2e-12 PF00534: Glycos_transf_1" amino acids 208 to 355 (148 residues), 123.7 bits, see alignment E=1.8e-39 PF13692: Glyco_trans_1_4" amino acids 215 to 353 (139 residues), 100 bits, see alignment E=4.5e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2936)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3L8 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BT2936 putative glycosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MHILILPMYYPEKDSSPHRGYMFFEQAMQLAKSGCKVGLAFTEQRPLKNFTWKRFRKESH
FQISAEDNGSFVTMRLHAWNPKLSTRAGGIIWSLLTVLLVRKYIRTYGRPDLIHAHFGTW
AGYAARLVYKWYKVPYVITEHASSINGNQTTPSQAVILKKAYSEARKIICVGTKLKRSLC
AYVSDPDKVTVIPNFVDTNTFAFSPHRTEKKKHFTFISIGNLNKRKGFWDLLTAFHWAFK
DMPHVSLIIAGDGEEMQPLKKLIQSLHLQEQVKLTGRLSREELSGLLGTCDAFVLASFAE
TFGIVFIEAMATGLPAIGTICGGPEDIITPESGFLIRPGDVDALAAKMKTLYDTYESFDK
EKIRQSIVSRFDFQLAGQKLRQVYSEALEMSKPPKASES