Protein Info for BT2880 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative nucleotide-sugar dehydratase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 239 to 255 (17 residues), see Phobius details PF02719: Polysacc_synt_2" amino acids 26 to 143 (118 residues), 20.4 bits, see alignment E=6.8e-08 PF01370: Epimerase" amino acids 26 to 266 (241 residues), 170.5 bits, see alignment E=1.1e-53 PF01073: 3Beta_HSD" amino acids 27 to 248 (222 residues), 56.3 bits, see alignment E=6.9e-19 PF16363: GDP_Man_Dehyd" amino acids 27 to 330 (304 residues), 85 bits, see alignment E=1.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2880)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3S4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>BT2880 putative nucleotide-sugar dehydratase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MMTYYDDIRKVQDLHLPWEILTDINILIVGASGLIGRALVDTLMQLPDKTFHLYAGVRDL
VYAQSCFMRYKDDESFTLIQCDVTALIPFDIDFHYIIHAASYAGPAAFHNDPVGVMKANI
LGVDNLFSYGEQHNLRRLLYVSSGEVYGEGNGIPFREEDSGSLDWASLRACYPAAKRTAE
TLCIAYAAQFQIETVIARPCHIYGPFYTSKDDRAYAQFIRNVLAGENIILRSSGLQQRSW
CYVVDCVFALLYVLLKGKTKNAYNIADVRSNVSIREFAEMIALKSEREVIFDLPDNTGKN
KPIISQAIFNTEKINKIGWFPQWKLEEGVSHTLNTLISVDGTYI