Protein Info for BT2804 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): ribokinase (EC 2.7.1.15)
Rationale: Specifically important in carbon source D-Ribose. An adjacent protein (BT2803) is also expected to be a ribokinase and is also required. It is not clear why both proteins are required.
Original annotation: ribokinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00294: PfkB" amino acids 2 to 292 (291 residues), 217.1 bits, see alignment E=1.8e-68 TIGR02152: ribokinase" amino acids 3 to 297 (295 residues), 334.7 bits, see alignment E=2.6e-104

Best Hits

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to bth:BT_2804)

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.15

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A400 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BT2804 ribokinase (EC 2.7.1.15) (Bacteroides thetaiotaomicron VPI-5482)
MKVVVIGSSNIDMVAQVNHLPAPGETVGDASFMQSLGGKGANQAVAAARLGGSVTFITSL
GNDMYAEILKKHFKKEGITTDYIIDDVNQPTGTALIFVADSGENCIAVAPGANYSLLPGS
IIHFSKVIDEADIIVMQAEIPYETIKRIALLAKQKGKKVLFNPAPACLIDEELMKAIDIL
VVNELEAAFISGIEYTGNNLEEIALSLLQAGARNAVITLGSQGVYMKNDKEIIQLPGYKV
NAIDTIAAGDTFCGALAVICAQREIDRDALSFANAAAAIAVTRSGAQPSIPTLDEVKHFM
LEKELALSFNF