Protein Info for BT2775 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative helicase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 PF08800: BT4734-like_N" amino acids 55 to 185 (131 residues), 145.7 bits, see alignment E=1.9e-46 PF05272: VapE-like_dom" amino acids 410 to 622 (213 residues), 110.7 bits, see alignment E=1.5e-35 PF19263: DUF5906" amino acids 462 to 570 (109 residues), 31.9 bits, see alignment E=3.7e-11 PF12990: DUF3874" amino acids 624 to 694 (71 residues), 88 bits, see alignment E=8.2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2775)

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A429 at UniProt or InterPro

Protein Sequence (702 amino acids)

>BT2775 putative helicase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKLTLMRDNGGTPTMRTLDINLQIEAMKHETKAQPISNLRTSIRYASPDAKLDDAKKLTK
VIPAAAFRKTANGIQMTAYNGIIQIEVNHLANLMEVNRVKQEAEELSQTYLAFMGSSGHS
VKIWVRFTRPDKSLPKNREEAEIFQAHAYRKAVSLYQPILSYSIELKNPALEQFCRQTYD
PELYYNPDSTIMYMRQPMEMPSETTYQEAVQAETSPFKRLIPGYDSLETLSALFEVALNK
ACQSLSELQPGIYPRSDEDLKPLLVQLAENCFQAGIPEEETARCAIAHLYRQKKEFLIRQ
TVQSVYTIAKGFGKKSPLSAEQELELRTEEFMQRRYEFRYNTMTTVTEYRERNTFCFYFR
PLSSRVRNSIAMNARLEGLSLWDRDVVRYLDSDRIPIFNPIEDFLFGLDVRWDGHDRIRE
LAARVPCNNRHWADLFYRWFLNMVAHWRQTDRKYANCTVPLLVGPQAYRKSTFCRSLLPP
ELQAYYTDRIDFSNKRDAEISLNRFALINMDEFDQNRVNQQAFLKHIFQKPIVNVRRPHG
TATQEMRRYASFIGTSNHKDLLTDTSGSRRYIVVDVTGPIDCSPIDYEQLYAQAMHDLYK
GERYWFDPEDEKVMNESNQEFQVMPIAEQLFHEYFRAATEGEECEQFLAIEILEQVQHDS
KIRVSDCNIIQFGRILQKNRVPSVHTKRGNVYRVVRIKAKRE