Protein Info for BT2771 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative serine/threonine-protein kinase pknB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 402 to 421 (20 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details PF00069: Pkinase" amino acids 4 to 252 (249 residues), 173.4 bits, see alignment E=1.3e-54 PF07714: PK_Tyr_Ser-Thr" amino acids 5 to 214 (210 residues), 98 bits, see alignment E=1.1e-31 PF03109: ABC1" amino acids 77 to 162 (86 residues), 41.2 bits, see alignment E=2.3e-14 PF00498: FHA" amino acids 275 to 332 (58 residues), 36.6 bits, see alignment 1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2771)

Predicted SEED Role

"putative serine/threonine-protein kinase pknB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A433 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BT2771 putative serine/threonine-protein kinase pknB (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MPEYELIKVIGQGGMGSVYEGRSGDGKRVAIKMMNSKATMNPEFKELFYIEAAALKKMRH
PSVVGIVDNPFSDEHGNMYLPMEYVDGETIEHHVEMAGPYTEFTAKDLMGKILDAMAYIH
RMGCIHRDIKPSNIMVRPDGSICIIDFGIAKDMKTSTGKTIGRIIGTDGYMSPEQAKGDS
IDYRTDIYSLGCLLHYMLTGSHAIKKRSNDYDTICSILNDEFPRAKTFNPHLSDQTQEAI
LKAVDKNMLRRFQTVMEFKSGLFRETVVDPNRVKVSVGRRECDITIPSDYISGHHLEIEY
REERCTGSIHRYLLFTDSSTNGTSVDGKYLRHGSIKIPFSFENPSPLPNVWLAGRSEYLL
DWDEVIQKLRDKGGRTVIMEEVVGDILPPTPPTPSVKEDKLGIGYGILSVVCPIVGWVLW
AQWKKETPRRARAAAICGWIGFVVGFIINILSSI