Protein Info for BT2756 in Bacteroides thetaiotaomicron VPI-5482

Annotation: anaerobic C4-dicarboxylate transporter dcuB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 132 to 158 (27 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 4 to 369 (366 residues), 513.4 bits, see alignment E=1.7e-158 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 4 to 434 (431 residues), 541.4 bits, see alignment E=8.8e-167

Best Hits

Swiss-Prot: 55% identical to DCUB_HAEIN: Anaerobic C4-dicarboxylate transporter DcuB (dcuB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07791, anaerobic C4-dicarboxylate transporter DcuA (inferred from 100% identity to bth:BT_2756)

MetaCyc: 50% identical to N-(1-deoxy-D-fructos-1-yl)-L-aspartate transporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
TRANS-RXN1R65-79

Predicted SEED Role

"Anaerobic C4-dicarboxylate transporter"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A447 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BT2756 anaerobic C4-dicarboxylate transporter dcuB (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MILQLAFVLTAIIIGARLGGIGLGVMGGVGLGILTFVFGLQPTAPPIDVMLMIAAVISAA
SCMQAAGGLDYMVKLAEHLLRKNPSHVTLLSPLVTYLFTFIAGTGHVAYSVLPVIAEVAT
ETKIRPERPLGIAVIASQQAITASPISAATVALLGLLAGFDITLFDILKITIPATIIGVL
VGALFSMKVGKELIEDPEYQKRLKEGLFNDKKIEIKDVKNKRSAMLSVLIFILATAFIVL
FGSFEGMRPSFLIDGEIVTLGMSSIIEIVMLSAAAIILIVTKTDGIKATQGSVFPAGMQA
VIAIFGIAWMGDTFLQGNMAQLTLSIEGIVRQMPWLFGIALFVMSILLYSQAATVRALMP
LGIALGISPYMLIALFPAVNGYFFIPNYPTVVAAINFDRTGTTKIGKYVLNHSFMMPGLV
STVVAIVLGLLFIQIF